PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G18960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 307aa    MW: 34218.8 Da    PI: 6.0413
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G18960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.21.4e-1162103346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T e+++l+++ ++ +G++ W +Ia++++ g+t++++k +w++
      AT1G18960.1  62 SFTSEDEDLIIKMHAAMGSR-WQLIAQHLP-GKTEEEVKMFWNT 103
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-1242112IPR009057Homeodomain-like
PROSITE profilePS5129416.32555109IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-1657109IPR009057Homeodomain-like
SMARTSM007171.1E-1259107IPR001005SANT/Myb domain
CDDcd001672.42E-962105No hitNo description
PfamPF002491.6E-1062103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVRSCSSKSK NPWTNEEDTT QKFVFASASK NGCAAPKKIG LRRCGKSCRV RKTDHSGTKH  60
ESFTSEDEDL IIKMHAAMGS RWQLIAQHLP GKTEEEVKMF WNTKLKKKLS EMGIDHVTHR  120
PFSHVLAEYG NINGGGNLNP NPSNQAGSLG RNHSLNDDGH QQQPNDSGDL MFHLQAIKLM  180
TDSSNQVKPE STFVYASSSS SNSSPPLFSS TCSTIAQENS EVNFTWSDFL LDQETFHENQ  240
QNHPQELDSL FGNDFSEVTA ATMANTSTVP SQIEEESLSN GFVESIIAKE KEFFLGFPSY  300
LEQPFHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-12101097108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453358820.0
Expression AtlasAT1G18960-
AtGenExpressAT1G18960-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00148DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G18960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G18960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934660.0AB493466.1 Arabidopsis thaliana At1g18960 mRNA for hypothetical protein, partial cds, clone: RAAt1g18960.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173330.10.0myb-like HTH transcriptional regulator family protein
TrEMBLQ9LMD10.0Q9LMD1_ARATH; F14D16.11
STRINGAT1G18960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148221518
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Wu XM,Lim SH,Yang WC
    Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid.
    Plant Mol. Biol., 2003. 51(6): p. 959-72
    [PMID:12777054]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]